PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_19163g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 258aa    MW: 28984.7 Da    PI: 8.426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_19163g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv  ++ +G g+W++ +   g+ R++k+c++rw +yl
    MA_19163g0010 14 KGAWTKEEDHRLVAHIRAHGEGCWRSLPMAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding58.21.8e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eEdel+++++ + G++ W++Ia++++ gRt++++k++w+++
    MA_19163g0010  67 RGNFSEEEDELIIKLHSLIGNK-WSLIAARLP-GRTDNEIKNHWNSH 111
                      89********************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.466961IPR017930Myb domain
SMARTSM007176.4E-111363IPR001005SANT/Myb domain
SuperFamilySSF466891.19E-2813108IPR009057Homeodomain-like
PfamPF002492.9E-131461IPR001005SANT/Myb domain
CDDcd001678.74E-91661No hitNo description
PROSITE profilePS5129429.19962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2865116IPR009057Homeodomain-like
SMARTSM007172.5E-1766114IPR001005SANT/Myb domain
PfamPF002496.5E-1767111IPR001005SANT/Myb domain
CDDcd001677.18E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRSPCCEKS HTNKGAWTKE EDHRLVAHIR AHGEGCWRSL PMAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SEEEDELIIK LHSLIGNKWS LIAARLPGRT DNEIKNHWNS HIKRKLASMG  120
LDPRSHRPLC LPHNSNTTCL SRPAPDHEIP AFQNRRTPEI TDFFQHHRSE SSPIERAASD  180
VEEHRDLDLD LNLCISLPSN LPPAANRGSS VHRTVVSYLN SGSGVCYPIG LQVNYGGYCE  240
SGYSAENAGG FSQYRLAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1228530.0BT122853.1 Picea sitchensis clone WS0462_C15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826645.17e-86PREDICTED: myb-related protein 308
SwissprotQ9SZP12e-83MYB4_ARATH; Transcription repressor MYB4
TrEMBLA5JYE91e-135A5JYE9_PICGL; R2R3-MYB transcription factor MYB5
STRINGSi012585m6e-84(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-84myb domain protein 4